| CDS ID | Os02t0610500-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:2:23989803:23991271:1 gene:Os02g0610500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CONSTANS-like gene 4, B-box-containing protein 5, CCT domain-containing gene 6, CCT (CO, CO-LIKE and TOC1) domain protein 6, CCT domain protein 6 description:CO-like protein containing two B-box zinc finger domains and one CCT domain, Constitutive flowering repressor (Os02t0610500-01) |
| Sequence | ATGGAGGCGGTGGAGGACAAGGCGATGGTGGGAGTGGGAGGAGCGGTGGCGGCGGGGTAC |
| PEP ID | Os02t0610500-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:2:23989803:23991271:1 gene:Os02g0610500 transcript:Os02t0610500-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CONSTANS-like gene 4, B-box-containing protein 5, CCT domain-containing gene 6, CCT (CO, CO-LIKE and TOC1) domain protein 6, CCT domain protein 6 description:CO-like protein containing two B-box zinc finger domains and one CCT domain, Constitutive flowering repressor (Os02t0610500-01) |
| Sequence | MEAVEDKAMVGVGGAVAAGYSSSSWGLGTRACDSCGGEAARLYCRADGAFLCARCDARAH |
| Transcript ID | Os02t0610500-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:2:23989803:23991271:1 gene:Os02g0610500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CONSTANS-like gene 4, B-box-containing protein 5, CCT domain-containing gene 6, CCT (CO, CO-LIKE and TOC1) domain protein 6, CCT domain protein 6 description:CO-like protein containing two B-box zinc finger domains and one CCT domain, Constitutive flowering repressor (Os02t0610500-01) |
| Sequence | GTGCCCAACGCCCAAAAAACACAGCCAAACTCCGCGAGAAACCGAGCTGCGAGCGAGTGA |