| CDS ID | Os02t0266300-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:2:9514364:9518253:-1 gene:Os02g0266300 gene_biotype:protein_coding transcript_biotype:protein_coding description:Similar to Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive-protein p120). (Os02t0266300-01);Similar to Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive-protein p120). (Os02t0266300-02) |
| Sequence | ATGCCGGTGCCGGGGAGCCAGAACGGGCGGCCGAGGCCGGCGAAGGCGGAGACCATCCAC |
| PEP ID | Os02t0266300-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:2:9514364:9518253:-1 gene:Os02g0266300 transcript:Os02t0266300-02 gene_biotype:protein_coding transcript_biotype:protein_coding description:Similar to Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive-protein p120). (Os02t0266300-01);Similar to Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive-protein p120). (Os02t0266300-02) |
| Sequence | MPVPGSQNGRPRPAKAETIHGLARAGDLAGVQRKLQENPALINDRNPVMSQTPLHVAAGY |
| Transcript ID | Os02t0266300-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:2:9514364:9518253:-1 gene:Os02g0266300 gene_biotype:protein_coding transcript_biotype:protein_coding description:Similar to Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive-protein p120). (Os02t0266300-01);Similar to Transient receptor potential cation channel subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive-protein p120). (Os02t0266300-02) |
| Sequence | TTTCTTCCTCGTCTCCTCCTCCTTTTCACACGCGCAAGCTGCTCGAGCGAGCGCGCACAC |