| CDS ID | Os02t0152500-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:2:2876561:2882177:-1 gene:Os02g0152500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:leaf inclination2, Leaf Inclination 2, VIN3-LIKE 2, VERNALIZATION INSENSITIVE 3-LIKE 3 description:Chromatin remodeling factor, Protein containing PHD domain, FNIII domain and VID domain, Positive regulator of flowering, Regulation of leaf angle (Os02t0152500-01);Non-protein coding transcript. (Os02t0152500-02) |
| Sequence | ATGGATCCACCCTACGCAGGAGTACCTATTGATCCTGCTAAATGCCGATTGATGAGTGTG |
| PEP ID | Os02t0152500-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:2:2876561:2882177:-1 gene:Os02g0152500 transcript:Os02t0152500-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:leaf inclination2, Leaf Inclination 2, VIN3-LIKE 2, VERNALIZATION INSENSITIVE 3-LIKE 3 description:Chromatin remodeling factor, Protein containing PHD domain, FNIII domain and VID domain, Positive regulator of flowering, Regulation of leaf angle (Os02t0152500-01);Non-protein coding transcript. (Os02t0152500-02) |
| Sequence | MDPPYAGVPIDPAKCRLMSVDEKRELVRELSKRPESAPDKLQSWSRREIVEILCADLGRE |
| Transcript ID | Os02t0152500-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:2:2876561:2882177:-1 gene:Os02g0152500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:leaf inclination2, Leaf Inclination 2, VIN3-LIKE 2, VERNALIZATION INSENSITIVE 3-LIKE 3 description:Chromatin remodeling factor, Protein containing PHD domain, FNIII domain and VID domain, Positive regulator of flowering, Regulation of leaf angle (Os02t0152500-01);Non-protein coding transcript. (Os02t0152500-02) |
| Sequence | GAGAGATAACTAGCAGAGCACTCGCGGAGGCGAGGAGAGAGAGAGAGAGAGAGAGAGGTT |