| CDS ID | Os01t0856500-04 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:37000257:37004643:1 gene:Os01g0856500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:like aux1-1, related to AUX1-1, auxin transporter 1 description:Auxin transporter, Primary root and root hair elongation, Cd stress response (Os01t0856500-01);Amino acid transporter, transmembrane domain containing protein. (Os01t0856500-02);Splicing variant with unknown function (Os01t0856500-03);Similar to auxin transporter-like protein 1. (Os01t0856500-04) |
| Sequence | ATCAACGACCGGCTGGACAAGCGGACGTGGACGTACATCTTCGGCGCGTGCTGCGCCACC |
| PEP ID | Os01t0856500-04 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:37000257:37004643:1 gene:Os01g0856500 transcript:Os01t0856500-04 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:like aux1-1, related to AUX1-1, auxin transporter 1 description:Auxin transporter, Primary root and root hair elongation, Cd stress response (Os01t0856500-01);Amino acid transporter, transmembrane domain containing protein. (Os01t0856500-02);Splicing variant with unknown function (Os01t0856500-03);Similar to auxin transporter-like protein 1. (Os01t0856500-04) |
| Sequence | INDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIAALLNGQAEG |
| Transcript ID | Os01t0856500-04 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:37000257:37004643:1 gene:Os01g0856500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:like aux1-1, related to AUX1-1, auxin transporter 1 description:Auxin transporter, Primary root and root hair elongation, Cd stress response (Os01t0856500-01);Amino acid transporter, transmembrane domain containing protein. (Os01t0856500-02);Splicing variant with unknown function (Os01t0856500-03);Similar to auxin transporter-like protein 1. (Os01t0856500-04) |
| Sequence | CATCAACGACCGGCTGGACAAGCGGACGTGGACGTACATCTTCGGCGCGTGCTGCGCCAC |