| CDS ID | Os01t0788800-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:33474895:33478422:1 gene:Os01g0788800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:TRANSCRIPTION FACTOR 1 description:Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-01);Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-02);Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-03) |
| Sequence | ATGAACAGGTTTTTCAGCATCTGTGGGCATCCCGATGATGGACAAAAGAGGCATCTGAGT |
| PEP ID | Os01t0788800-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:33474895:33478422:1 gene:Os01g0788800 transcript:Os01t0788800-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:TRANSCRIPTION FACTOR 1 description:Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-01);Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-02);Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-03) |
| Sequence | MNRFFSICGHPDDGQKRHLSETTGLGLDQVKFWFQNKRTQVKTMCWKEENYKLSVENEIL |
| Transcript ID | Os01t0788800-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:33474895:33478422:1 gene:Os01g0788800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:TRANSCRIPTION FACTOR 1 description:Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-01);Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-02);Similar to Isoform 2 of Homeobox-leucine zipper protein TF1. (Os01t0788800-03) |
| Sequence | AGGTGTTTAGTGAGAATTAGCTTTATAAAAATGTTTAGTGGGTATTAGCTTTATAAAAAG |