| CDS ID | Os01t0705700-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:29271158:29273175:1 gene:Os01g0705700 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:inducer of CBF expression 1, basic helix-loop-helix protein 010, OsMYC2-like protein 1, MYC2-like protein 1 description:Similar to Transcription factor ICE1 (Inducer of CBF expression 1) (Basic helix- loop-helix protein 116) (bHLH116) (AtbHLH116). (Os01t0705700-01) |
| Sequence | ATGTCGTGGTCCGAGACGGACGCCGCGCTGTTCGCGGCGGTGCTGGGGCACGACGCGGCG |
| PEP ID | Os01t0705700-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:29271158:29273175:1 gene:Os01g0705700 transcript:Os01t0705700-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:inducer of CBF expression 1, basic helix-loop-helix protein 010, OsMYC2-like protein 1, MYC2-like protein 1 description:Similar to Transcription factor ICE1 (Inducer of CBF expression 1) (Basic helix- loop-helix protein 116) (bHLH116) (AtbHLH116). (Os01t0705700-01) |
| Sequence | MSWSETDAALFAAVLGHDAAHHLATTPPHLDAPEGSPSSAELQASLHDLVERQGGAWTYG |
| Transcript ID | Os01t0705700-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:29271158:29273175:1 gene:Os01g0705700 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:inducer of CBF expression 1, basic helix-loop-helix protein 010, OsMYC2-like protein 1, MYC2-like protein 1 description:Similar to Transcription factor ICE1 (Inducer of CBF expression 1) (Basic helix- loop-helix protein 116) (bHLH116) (AtbHLH116). (Os01t0705700-01) |
| Sequence | ACATCGCGCATCCACTCCACACCACACGCTTCACTGGTTCCGAGCACTCGCCACCGATAC |