| CDS ID | Os01t0691600-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:28545585:28553746:1 gene:Os01g0691600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Xeroderma pigmentosum (XP) complementation group of protein B2 description:Similar to DNA repair helicase XPB2 (EC 3.6.1.-) (XPB homolog 2) (ERCC3 homolog 2) (RAD25 homolog 2) (AtXPB2). (Os01t0691600-01);Similar to XPB1 (ARABIDOPSIS HOMOLOG OF XERODERMA PIGMENTOSUM COMPLEMENTATION GROUP B 1); ATP-dependent helicase. (Os01t0691600-02) |
| Sequence | ATGGCCGGCGGCGACGGCGATCGCGCCCGCGCGCCGAAGCGGCACAAGTCCTCGGCGCCG |
| PEP ID | Os01t0691600-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:28545585:28553746:1 gene:Os01g0691600 transcript:Os01t0691600-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Xeroderma pigmentosum (XP) complementation group of protein B2 description:Similar to DNA repair helicase XPB2 (EC 3.6.1.-) (XPB homolog 2) (ERCC3 homolog 2) (RAD25 homolog 2) (AtXPB2). (Os01t0691600-01);Similar to XPB1 (ARABIDOPSIS HOMOLOG OF XERODERMA PIGMENTOSUM COMPLEMENTATION GROUP B 1); ATP-dependent helicase. (Os01t0691600-02) |
| Sequence | MAGGDGDRARAPKRHKSSAPSRSIDETAELDYTDDVDDDVRDADREVKKRDFTKLELKPD |
| Transcript ID | Os01t0691600-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:28545585:28553746:1 gene:Os01g0691600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Xeroderma pigmentosum (XP) complementation group of protein B2 description:Similar to DNA repair helicase XPB2 (EC 3.6.1.-) (XPB homolog 2) (ERCC3 homolog 2) (RAD25 homolog 2) (AtXPB2). (Os01t0691600-01);Similar to XPB1 (ARABIDOPSIS HOMOLOG OF XERODERMA PIGMENTOSUM COMPLEMENTATION GROUP B 1); ATP-dependent helicase. (Os01t0691600-02) |
| Sequence | GGCGACGAGAAGACGAAACTGCCCCGTGCGCCGCCAACATCTCCCCTCTCCGGCTACCGC |