Oryza sativa| CDS ID | Os01t0691300-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:28538881:28539369:-1 gene:Os01g0691300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:non-specific lipid transfer protein 2.2, lipid transfer protein 2.2, type 2 non-specific lipid transfer protein 2 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os01t0691300-01) |
| Sequence | ATGACGACGAGGCCTTCTGTTTTTTCCACCGTTGTCGCGGCGATCGCCATCGCCGCGCTG |
| PEP ID | Os01t0691300-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:28538881:28539369:-1 gene:Os01g0691300 transcript:Os01t0691300-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:non-specific lipid transfer protein 2.2, lipid transfer protein 2.2, type 2 non-specific lipid transfer protein 2 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os01t0691300-01) |
| Sequence | MTTRPSVFSTVVAAIAIAALLSSLLLLQATPAAASARASKKASCDLMQLSPCVSAFSGVG |
| Transcript ID | Os01t0691300-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:28538881:28539369:-1 gene:Os01g0691300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:non-specific lipid transfer protein 2.2, lipid transfer protein 2.2, type 2 non-specific lipid transfer protein 2 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os01t0691300-01) |
| Sequence | CATCCTAGCATCCCGGTGTCCAGCAAGAGATCCATCAAGCCGTCGCGATGACGACGAGGC |