| CDS ID | Os01t0678500-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:27906660:27920895:-1 gene:Os01g0678500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:TWO-PORE CHANNEL 1 description:Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade (Os01t0678500-01);Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade (Os01t0678500-02) |
| Sequence | ATGAGGGAGAGGGGAGAGATGAGGGAGGCGAAGGCGCCTCTGATCGCGGAGGCGGCGGAG |
| PEP ID | Os01t0678500-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:27906660:27920895:-1 gene:Os01g0678500 transcript:Os01t0678500-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:TWO-PORE CHANNEL 1 description:Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade (Os01t0678500-01);Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade (Os01t0678500-02) |
| Sequence | MRERGEMREAKAPLIAEAAEHISHSHGSGSSGTGSHTSGGGGGWRGSRQYQRRSDALAYG |
| Transcript ID | Os01t0678500-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:27906660:27920895:-1 gene:Os01g0678500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:TWO-PORE CHANNEL 1 description:Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade (Os01t0678500-01);Voltage-gated Ca2+ channel protein, Elicitor-induced defense reponses, Hypersensitive cell death, Activation of MAPK cascade (Os01t0678500-02) |
| Sequence | CTTCTACTTCCGCTTCCGCTCGCGGTTCCAGATCTCTCCCTGCACATCTGCATCCACTCA |