| CDS ID | Os01t0665200-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:27176103:27178076:1 gene:Os01g0665200 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MAP kinase 20-4, Wound- and JA-uninducible MAP kinase 1 description:Similar to Blast and wounding induced mitogen-activated protein kinase. (Os01t0665200-01);Similar to Mitogen activated protein kinase 20-4. (Os01t0665200-02);Similar to Mitogen-activated protein kinase 8. (Os01t0665200-03) |
| Sequence | ATGAGGAAAAAGCAGCCAGTACCTTTTTCTGAGAGATTCCCAAAAGCAGATCCTGCTGCA |
| PEP ID | Os01t0665200-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:27176103:27178076:1 gene:Os01g0665200 transcript:Os01t0665200-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MAP kinase 20-4, Wound- and JA-uninducible MAP kinase 1 description:Similar to Blast and wounding induced mitogen-activated protein kinase. (Os01t0665200-01);Similar to Mitogen activated protein kinase 20-4. (Os01t0665200-02);Similar to Mitogen-activated protein kinase 8. (Os01t0665200-03) |
| Sequence | MRKKQPVPFSERFPKADPAALKLLQRLLAFDPKDRPTAEEALADPYFKGLAKAEREPSCQ |
| Transcript ID | Os01t0665200-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:27176103:27178076:1 gene:Os01g0665200 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MAP kinase 20-4, Wound- and JA-uninducible MAP kinase 1 description:Similar to Blast and wounding induced mitogen-activated protein kinase. (Os01t0665200-01);Similar to Mitogen activated protein kinase 20-4. (Os01t0665200-02);Similar to Mitogen-activated protein kinase 8. (Os01t0665200-03) |
| Sequence | CGGAATGAGAAAGCAAGGAGGTACTTGAGCAGTATGAGGAAAAAGCAGCCAGTACCTTTT |