| CDS ID | Os01t0208600-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:5894496:5898181:1 gene:Os01g0208600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:EARLY SENESCENCE 1 description:SCAR-like protein 2, Component of the suppressor of cAMP receptor/Wiskott-Aldrich syndrome protein family verprolin-homologous (SCAR/WAVE) complex, Actin organization, Panicle development, Regulation of water loss (Os01t0208600-01);Actin-binding WH2 domain containing protein. (Os01t0208600-02);Actin-binding WH2 domain containing protein. (Os01t0208600-03) |
| Sequence | GTGAAACCAGTACCTTCTCTCAATGTTGATGTGCCTCAGGTGGAGCTGATAGATAACATT |
| PEP ID | Os01t0208600-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:5894496:5898181:1 gene:Os01g0208600 transcript:Os01t0208600-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:EARLY SENESCENCE 1 description:SCAR-like protein 2, Component of the suppressor of cAMP receptor/Wiskott-Aldrich syndrome protein family verprolin-homologous (SCAR/WAVE) complex, Actin organization, Panicle development, Regulation of water loss (Os01t0208600-01);Actin-binding WH2 domain containing protein. (Os01t0208600-02);Actin-binding WH2 domain containing protein. (Os01t0208600-03) |
| Sequence | VKPVPSLNVDVPQVELIDNIVTESPDSSVAEFPDAYQNSSMPPAPESAADFPSLSSADAP |
| Transcript ID | Os01t0208600-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:5894496:5898181:1 gene:Os01g0208600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:EARLY SENESCENCE 1 description:SCAR-like protein 2, Component of the suppressor of cAMP receptor/Wiskott-Aldrich syndrome protein family verprolin-homologous (SCAR/WAVE) complex, Actin organization, Panicle development, Regulation of water loss (Os01t0208600-01);Actin-binding WH2 domain containing protein. (Os01t0208600-02);Actin-binding WH2 domain containing protein. (Os01t0208600-03) |
| Sequence | GAGTGAAACCAGTACCTTCTCTCAATGTTGATGTGCCTCAGGTGGAGCTGATAGATAACA |