| CDS ID | Os01t0191300-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:4879215:4885839:-1 gene:Os01g0191300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:NAC domain-containing protein 003, NAC domain-containing protein 3, NAC domain-containing protein 16, stress-responsive NAC transcription factor 3 description:Similar to NAC-type transcription factor. (Os01t0191300-01);Similar to NAC-type transcription factor. (Os01t0191300-02);Similar to NAC-type transcription factor. (Os01t0191300-03) |
| Sequence | ATGGTGAGCGGCCGGCAGAAGGGGTGCAAGAAGATACTGGTCCTCTACACCAACTTCGGC |
| PEP ID | Os01t0191300-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:4879215:4885839:-1 gene:Os01g0191300 transcript:Os01t0191300-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:NAC domain-containing protein 003, NAC domain-containing protein 3, NAC domain-containing protein 16, stress-responsive NAC transcription factor 3 description:Similar to NAC-type transcription factor. (Os01t0191300-01);Similar to NAC-type transcription factor. (Os01t0191300-02);Similar to NAC-type transcription factor. (Os01t0191300-03) |
| Sequence | MVSGRQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGDLEEEKEGELVVCKIFYQTQPR |
| Transcript ID | Os01t0191300-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:4879215:4885839:-1 gene:Os01g0191300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:NAC domain-containing protein 003, NAC domain-containing protein 3, NAC domain-containing protein 16, stress-responsive NAC transcription factor 3 description:Similar to NAC-type transcription factor. (Os01t0191300-01);Similar to NAC-type transcription factor. (Os01t0191300-02);Similar to NAC-type transcription factor. (Os01t0191300-03) |
| Sequence | TTTGCTCTTCTACTGCTCATCCTCCTCCTCTACTACTCGTCCTCTTTGCTCTATTCACAG |