| CDS ID | Os01t0104600-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:1:248828:256571:-1 gene:Os01g0104600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DE-ETIOLATED1 description:Homolog of Arabidopsis DE-ETIOLATED1 (DET1), Modulation of the ABA signaling pathway and ABA biosynthesis, Regulation of chlorophyll content (Os01t0104600-01);Similar to Light-mediated development protein DET1 (Deetiolated1 homolog) (tDET1) (High pigmentation protein 2) (Protein dark green). (Os01t0104600-02) |
| Sequence | ATGGCGACCTTCTTCCGCAGCGCCAACCTCGCCTCCAGGGTCTTCGACCGCCAGTTCCTC |
| PEP ID | Os01t0104600-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:1:248828:256571:-1 gene:Os01g0104600 transcript:Os01t0104600-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DE-ETIOLATED1 description:Homolog of Arabidopsis DE-ETIOLATED1 (DET1), Modulation of the ABA signaling pathway and ABA biosynthesis, Regulation of chlorophyll content (Os01t0104600-01);Similar to Light-mediated development protein DET1 (Deetiolated1 homolog) (tDET1) (High pigmentation protein 2) (Protein dark green). (Os01t0104600-02) |
| Sequence | MATFFRSANLASRVFDRQFLSPRPGATVNTVRQFYENLVPSYTICDIDCPDYSFRKFTDD |
| Transcript ID | Os01t0104600-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:1:248828:256571:-1 gene:Os01g0104600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DE-ETIOLATED1 description:Homolog of Arabidopsis DE-ETIOLATED1 (DET1), Modulation of the ABA signaling pathway and ABA biosynthesis, Regulation of chlorophyll content (Os01t0104600-01);Similar to Light-mediated development protein DET1 (Deetiolated1 homolog) (tDET1) (High pigmentation protein 2) (Protein dark green). (Os01t0104600-02) |
| Sequence | AGAGAGCAGACACCACCACACCATCCAACCAACCAAATTCCTCTCTCCTCCGCCGCGCCC |