| CDS ID | Zm00001d043185_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:3:190866499:190869969:1 gene:Zm00001d043185 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: mucin-related (TAIR:AT2G02880.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (sou /.../CBI BLink). |
| Sequence | ATGTTCGTCCTCCGCAAAACCCTCCTCCATGCGCCGCCGGCCGCCGCCGCGGCGGTCCCC |
| PEP ID | Zm00001d043185_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:3:190866499:190869969:1 gene:Zm00001d043185 transcript:Zm00001d043185_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: mucin-related (TAIR:AT2G02880.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (sou /.../CBI BLink). |
| Sequence | MFVLRKTLLHAPPAAAAAVPSRISSLLRLIPSASFSEVSGGGEEWGASSPGGGGGRGGGG |
| Transcript ID | Zm00001d043185_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:3:190866499:190869969:1 gene:Zm00001d043185 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: mucin-related (TAIR:AT2G02880.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (sou /.../CBI BLink). |
| Sequence | ACCAGCGAAACCCCAGAATGTTCGTCCTCCGCAAAACCCTCCTCCATGCGCCGCCGGCCG |