| CDS ID | Zm00001d031941_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:1:207588117:207591806:1 gene:Zm00001d031941 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Kinase phosphorylation domain (InterPro:IPR019315); Has 8882 Blast hits to 4920 proteins in 346 species: Archae - 10; Bacteria - 184; Metazoa - 3955; Fungi - 1221; Plants - 712; Viruses - 24; Other Eukaryotes - 2776 (sour /.../BI BLink). |
| Sequence | ATGTACCATCCCACGAGAGGCGGCGTCCGCGGCGGCAGAGATCAATTCAAATGGGACGAT |
| PEP ID | Zm00001d031941_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:1:207588117:207591806:1 gene:Zm00001d031941 transcript:Zm00001d031941_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Kinase phosphorylation domain (InterPro:IPR019315); Has 8882 Blast hits to 4920 proteins in 346 species: Archae - 10; Bacteria - 184; Metazoa - 3955; Fungi - 1221; Plants - 712; Viruses - 24; Other Eukaryotes - 2776 (sour /.../BI BLink). |
| Sequence | MYHPTRGGVRGGRDQFKWDDVKVDKHRENYLGHSVKAPVGRWQKGKDLYWYTRDKKSDTE |
| Transcript ID | Zm00001d031941_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:1:207588117:207591806:1 gene:Zm00001d031941 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Kinase phosphorylation domain (InterPro:IPR019315); Has 8882 Blast hits to 4920 proteins in 346 species: Archae - 10; Bacteria - 184; Metazoa - 3955; Fungi - 1221; Plants - 712; Viruses - 24; Other Eukaryotes - 2776 (sour /.../BI BLink). |
| Sequence | GTTGACTGGGCCGTCATTTACTAGCCCATGGGCCATACGGCTGTCTCAGGTCTCAGCACC |