| CDS ID | Zm00001d029303_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:1:65496452:65501448:-1 gene:Zm00001d029303 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Hepatocellular carcinoma-associated antigen 59 (InterPro:IPR010756); Has 1239 Blast hits to 998 proteins in 204 species: Archae - 4; Bacteria - 71; Metazoa - 421; Fungi - 109; Plants - 87; Viruses - 5; Other Eukaryotes - /.../ource: NCBI BLink). |
| Sequence | ATGCCGCGAAACTTCCGCAAGCGGGGCATCGAGCAGGACACTGACGACCGCTCCGACGAC |
| PEP ID | Zm00001d029303_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:1:65496452:65501448:-1 gene:Zm00001d029303 transcript:Zm00001d029303_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Hepatocellular carcinoma-associated antigen 59 (InterPro:IPR010756); Has 1239 Blast hits to 998 proteins in 204 species: Archae - 4; Bacteria - 71; Metazoa - 421; Fungi - 109; Plants - 87; Viruses - 5; Other Eukaryotes - /.../ource: NCBI BLink). |
| Sequence | MPRNFRKRGIEQDTDDRSDDEDTRRIALEEIKYMQKLRERKLGIPADLAAASTNGSSARG |
| Transcript ID | Zm00001d029303_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:1:65496452:65501448:-1 gene:Zm00001d029303 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Hepatocellular carcinoma-associated antigen 59 (InterPro:IPR010756); Has 1239 Blast hits to 998 proteins in 204 species: Archae - 4; Bacteria - 71; Metazoa - 421; Fungi - 109; Plants - 87; Viruses - 5; Other Eukaryotes - /.../ource: NCBI BLink). |
| Sequence | AAAAAGTCGTTCGGGATTCAAACCCTTCGATCCCAAATCTGCCCTGCACGCCTCGCCGCC |