| CDS ID | Zm00001d020851_T003 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:7:134654920:134662924:1 gene:Zm00001d020851 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Inner centromere protein ARK-binding region (InterPro:IPR005635); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 3 /.../urce: NCBI BLink). |
| Sequence | ATGGGAAGGTTGTTGCTTAATCATGTTAAGTCAAGAAATTTGAACCCTGACAGTGAACCA |
| PEP ID | Zm00001d020851_P003 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:7:134654920:134662924:1 gene:Zm00001d020851 transcript:Zm00001d020851_T003 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Inner centromere protein ARK-binding region (InterPro:IPR005635); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 3 /.../urce: NCBI BLink). |
| Sequence | MGRLLLNHVKSRNLNPDSEPVEQHHKYTSECGHPDLTSMHSPNKKPSLTCPVEAPNSMGE |
| Transcript ID | Zm00001d020851_T003 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:7:134654920:134662924:1 gene:Zm00001d020851 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Inner centromere protein ARK-binding region (InterPro:IPR005635); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 3 /.../urce: NCBI BLink). |
| Sequence | GTAACCATCTTGATCTTGCTTTTACAAATCCTTCAAGTGAAGACCCATCTTCTACCAGTT |