| CDS ID | Zm00001d015433_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:5:89796563:89800151:-1 gene:Zm00001d015433 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Mitotic checkpoint protein PRCC C-terminal (InterPro:IPR018800); Has 930 Blast hits to 533 proteins in 146 species: Archae - 0; Bacteria - 18; Metazoa - 327; Fungi - 143; Plants - 61; Viruses - 0; Other Eukaryotes - 381 /.../e: NCBI BLink). |
| Sequence | ATGGACTCTCTCCTCGCCACCTACGCCTCTTCTGACGACGACGCTGACTCCGACGAGGCC |
| PEP ID | Zm00001d015433_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:5:89796563:89800151:-1 gene:Zm00001d015433 transcript:Zm00001d015433_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Mitotic checkpoint protein PRCC C-terminal (InterPro:IPR018800); Has 930 Blast hits to 533 proteins in 146 species: Archae - 0; Bacteria - 18; Metazoa - 327; Fungi - 143; Plants - 61; Viruses - 0; Other Eukaryotes - 381 /.../e: NCBI BLink). |
| Sequence | MDSLLATYASSDDDADSDEAPSTAPAASSGGRAGGLFSLPQPKSAPALLFSSLPAPKSTP |
| Transcript ID | Zm00001d015433_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:5:89796563:89800151:-1 gene:Zm00001d015433 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Mitotic checkpoint protein PRCC C-terminal (InterPro:IPR018800); Has 930 Blast hits to 533 proteins in 146 species: Archae - 0; Bacteria - 18; Metazoa - 327; Fungi - 143; Plants - 61; Viruses - 0; Other Eukaryotes - 381 /.../e: NCBI BLink). |
| Sequence | AAGAGAAAAAAACGAATAAATATTGGCACCGTTTTCATCTCTAGCGCGCGTCGCCGGCTT |