| CDS ID | Zm00001d015367_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:5:86479071:86481259:-1 gene:Zm00001d015367 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Ribonuclease H2 subunit C (InterPro:IPR013924); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (sou /.../CBI BLink). |
| Sequence | ATGGAGCCGGCGACCCCTCCGGCACCCGCCGCCGGCGTCACGGCTACCGTCGACCTCTCC |
| PEP ID | Zm00001d015367_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:5:86479071:86481259:-1 gene:Zm00001d015367 transcript:Zm00001d015367_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Ribonuclease H2 subunit C (InterPro:IPR013924); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (sou /.../CBI BLink). |
| Sequence | MEPATPPAPAAGVTATVDLSSVAADLGGAHLLPCGIRQNGGAPVSDYFKPRDTGVEVEGV |
| Transcript ID | Zm00001d015367_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:5:86479071:86481259:-1 gene:Zm00001d015367 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Ribonuclease H2 subunit C (InterPro:IPR013924); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (sou /.../CBI BLink). |
| Sequence | AAGTTGTGGGCTGACTCTCCTAATTTCCTTCCCGTTTTTCTTCCTGTGGTCGCTCGTTGA |