| CDS ID | Zm00001d015141_T003 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:5:76867745:76871787:-1 gene:Zm00001d015141 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Ubiquitin-conjugating enzyme E2C-binding protein (InterPro:IPR019193); Has 26 Blast hits to 25 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (sourc /.../I BLink). |
| Sequence | ATGGCCGGCGCCGTCTCCGTCTCCGCTCACCGGCGGCAATGGCGGTACACGTGGGAAGCC |
| PEP ID | Zm00001d015141_P003 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:5:76867745:76871787:-1 gene:Zm00001d015141 transcript:Zm00001d015141_T003 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Ubiquitin-conjugating enzyme E2C-binding protein (InterPro:IPR019193); Has 26 Blast hits to 25 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (sourc /.../I BLink). |
| Sequence | MAGAVSVSAHRRQWRYTWEALNHLPLLRLYLLPRAALPFRIPSDLRADLRLQGSLLHLSF |
| Transcript ID | Zm00001d015141_T003 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:5:76867745:76871787:-1 gene:Zm00001d015141 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Ubiquitin-conjugating enzyme E2C-binding protein (InterPro:IPR019193); Has 26 Blast hits to 25 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 26; Viruses - 0; Other Eukaryotes - 0 (sourc /.../I BLink). |
| Sequence | CACTTTTCCCGCCCATACGCAAGGAATGGCCGGCGCCGTCTCCGTCTCCGCTCACCGGCG |