| CDS ID | Zm00001d014783_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:5:62948202:62951476:1 gene:Zm00001d014783 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: kinectin-related (TAIR:AT5G66250.3); Has 7578 Blast hits to 6129 proteins in 783 species: Archae - 220; Bacteria - 1045; Metazoa - 3605; Fungi - 575; Plants - 442; Viruses - 38; Other Eukaryotes - 1653 (so /.../NCBI BLink). |
| Sequence | ATGGAGCAGCCTGCCGCTCCCGATCGGAGCGATTTTCCCGCCGGGGAGTGCGAATGGCGG |
| PEP ID | Zm00001d014783_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:5:62948202:62951476:1 gene:Zm00001d014783 transcript:Zm00001d014783_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: kinectin-related (TAIR:AT5G66250.3); Has 7578 Blast hits to 6129 proteins in 783 species: Archae - 220; Bacteria - 1045; Metazoa - 3605; Fungi - 575; Plants - 442; Viruses - 38; Other Eukaryotes - 1653 (so /.../NCBI BLink). |
| Sequence | MEQPAAPDRSDFPAGECEWREELRQQQSQVDALRERLVEAKVGLRCSEGDSRKELEHLCR |
| Transcript ID | Zm00001d014783_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:5:62948202:62951476:1 gene:Zm00001d014783 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: kinectin-related (TAIR:AT5G66250.3); Has 7578 Blast hits to 6129 proteins in 783 species: Archae - 220; Bacteria - 1045; Metazoa - 3605; Fungi - 575; Plants - 442; Viruses - 38; Other Eukaryotes - 1653 (so /.../NCBI BLink). |
| Sequence | GAAGAAAAGAAAAGAGAAGGAACAATGAAGCATACCAAAACCCAATCAGAATCAGGGTGG |