| CDS ID | Zm00001d014419_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:5:45785643:45787979:-1 gene:Zm00001d014419 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: Chalcone-flavanone isomerase family protein (TAIR:AT5G66230.1); Has 39 Blast hits to 39 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes /.../ource: NCBI BLink). |
| Sequence | ATGGAGACGCCGCTGTCTTCCAGGAGGATCACCCGCTCGCTCGCCGCCGCATCTGCCCAG |
| PEP ID | Zm00001d014419_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:5:45785643:45787979:-1 gene:Zm00001d014419 transcript:Zm00001d014419_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: Chalcone-flavanone isomerase family protein (TAIR:AT5G66230.1); Has 39 Blast hits to 39 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes /.../ource: NCBI BLink). |
| Sequence | METPLSSRRITRSLAAASAQKSAAAGPDSAALFSRAKNAAAGETQPRAALHDITNDSPIV |
| Transcript ID | Zm00001d014419_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:5:45785643:45787979:-1 gene:Zm00001d014419 gene_biotype:protein_coding transcript_biotype:protein_coding description:BEST Arabidopsis thaliana protein match is: Chalcone-flavanone isomerase family protein (TAIR:AT5G66230.1); Has 39 Blast hits to 39 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes /.../ource: NCBI BLink). |
| Sequence | CTTGCACACCAGCAGCAACAAACCACGCAACGGCTAGTACGGAAGAAGAGGGGCGAGCGG |