| CDS ID | Zm00001d009161_T003 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:8:40267887:40271679:-1 gene:Zm00001d009161 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Craniofacial development protein 1/Bucentaur (InterPro:IPR011421); Has 333 Blast hits to 324 proteins in 149 species: Archae - 0; Bacteria - 18; Metazoa - 117; Fungi - 96; Plants - 49; Viruses - 0; Other Eukaryotes - 53 ( /.../: NCBI BLink). |
| Sequence | ATGGCGTCAACTAGCTCTATAGGCGACGTGGGAGCCTCAGATGCAAAATCACGTGTGGAG |
| PEP ID | Zm00001d009161_P003 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:8:40267887:40271679:-1 gene:Zm00001d009161 transcript:Zm00001d009161_T003 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Craniofacial development protein 1/Bucentaur (InterPro:IPR011421); Has 333 Blast hits to 324 proteins in 149 species: Archae - 0; Bacteria - 18; Metazoa - 117; Fungi - 96; Plants - 49; Viruses - 0; Other Eukaryotes - 53 ( /.../: NCBI BLink). |
| Sequence | MASTSSIGDVGASDAKSRVEDVWKKMNGGFPNKMPKPAMTKLSSTATEKKNKPTNNWMTV |
| Transcript ID | Zm00001d009161_T003 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:8:40267887:40271679:-1 gene:Zm00001d009161 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Craniofacial development protein 1/Bucentaur (InterPro:IPR011421); Has 333 Blast hits to 324 proteins in 149 species: Archae - 0; Bacteria - 18; Metazoa - 117; Fungi - 96; Plants - 49; Viruses - 0; Other Eukaryotes - 53 ( /.../: NCBI BLink). |
| Sequence | GCTTCCGCCGGCCGAGTCCCGAGCGGAGCCGAAGCAACAACCGCCGGGGAGGCGAGGGAT |