| CDS ID | Zm00001d006124_T001 |
| CDS Infomation | cds chromosome:B73_RefGen_v4:2:199251572:199256700:1 gene:Zm00001d006124 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix Nulp1-type (InterPro:IPR006994); Has 2929 Blast hits to 2464 proteins in 333 species: Archae - 2; Bacteria - 151; Metazoa - 913; Fungi - 372; Plants - 141; Viruses - 47; Other Eukaryotes - 1303 (so /.../NCBI BLink). |
| Sequence | ATGTCCGCCAGGTTGCTCCGGCGAGTCCTCCAGGAGCGTGAGGCCACCCCGCAGGACACC |
| PEP ID | Zm00001d006124_P001 |
| PEP Infomation | pep chromosome:B73_RefGen_v4:2:199251572:199256700:1 gene:Zm00001d006124 transcript:Zm00001d006124_T001 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix Nulp1-type (InterPro:IPR006994); Has 2929 Blast hits to 2464 proteins in 333 species: Archae - 2; Bacteria - 151; Metazoa - 913; Fungi - 372; Plants - 141; Viruses - 47; Other Eukaryotes - 1303 (so /.../NCBI BLink). |
| Sequence | MSARLLRRVLQEREATPQDTDVADDDQSVEEEASPPRSSARNLFDLLDDGNGDGGEEDEK |
| Transcript ID | Zm00001d006124_T001 |
| Transcript Infomation | cdna chromosome:B73_RefGen_v4:2:199251572:199256700:1 gene:Zm00001d006124 gene_biotype:protein_coding transcript_biotype:protein_coding description:CONTAINS InterPro DOMAIN/s: Basic helix-loop-helix Nulp1-type (InterPro:IPR006994); Has 2929 Blast hits to 2464 proteins in 333 species: Archae - 2; Bacteria - 151; Metazoa - 913; Fungi - 372; Plants - 141; Viruses - 47; Other Eukaryotes - 1303 (so /.../NCBI BLink). |
| Sequence | ACATTTCTGAAGTCGTCCTGGCTCCCTTGGGTCGGAAAAGGCCAAAAACTCATCGGCAAC |